PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G201388.1.p
Common NameSb10g024950, SORBIDRAFT_10g024950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 314aa    MW: 33378.3 Da    PI: 8.3042
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G201388.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.53.5e-191156147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          rg+W++eEd+ l ++v+++G ++W++I r+++ gR++k+c++rw + 
  Sobic.010G201388.1.p 11 RGPWSPEEDDALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 56
                          89******************************.***********985 PP

2Myb_DNA-binding56.18.4e-1863105145
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                           r ++T+eEd  +v+a+++lG++ W++Iar ++ gRt++ +k++w+
  Sobic.010G201388.1.p  63 RRPFTPEEDAAIVRAHARLGNR-WAAIARLLP-GRTDNAVKNHWN 105
                           679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.62661IPR017930Myb domain
SuperFamilySSF466891.8E-318104IPR009057Homeodomain-like
SMARTSM007175.3E-171059IPR001005SANT/Myb domain
PfamPF002491.5E-181156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-251264IPR009057Homeodomain-like
CDDcd001678.50E-161355No hitNo description
SMARTSM007173.0E-1662110IPR001005SANT/Myb domain
PROSITE profilePS5129420.74163112IPR017930Myb domain
PfamPF002493.0E-1563105IPR001005SANT/Myb domain
CDDcd001671.81E-1265105No hitNo description
Gene3DG3DSA:1.10.10.601.7E-2365112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGAEAECDRI RGPWSPEEDD ALRRLVERHG ARNWTAIGRE IPGRSGKSCR LRWCNQLSPQ  60
VERRPFTPEE DAAIVRAHAR LGNRWAAIAR LLPGRTDNAV KNHWNCSLKR KLAVATTAAA  120
VSGSGVVSAD AAAEIEATRP IKRVSLSPDS PSGSGSGSGS RSDRSDLSHG SGSGSGQIYR  180
PVARSGGFEP ADCAMSRPQE DDDPLTSLSL SLPGTDHQRF HHDRAHSQFQ ELPASPPSPS  240
PPSPAAAPPS AYPFSPDFMA AMQELIRTEV QRYMASVGVR AGCGATGGAA DLCMPQLVEG  300
VMRAAAERVG RMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-4081124108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794290.0HF679429.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB23 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438718.10.0hypothetical protein SORBIDRAFT_10g024950
TrEMBLC5Z6L00.0C5Z6L0_SORBI; Putative uncharacterized protein Sb10g024950
STRINGSb10g024950.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78938154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.15e-56myb domain protein r1